PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_09920-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family NF-YA
Protein Properties Length: 231aa    MW: 25057.9 Da    PI: 9.8626
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_09920-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA102.92.9e-32152208158
        CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                      +ep+YVNaKQy++Il+RRq+Rak+e e+k  +k+rkpylheSRh+hA+rR+Rg+gGrF
  TRIUR3_09920-P1 152 EEPVYVNAKQYHGILRRRQSRAKAELERKA-IKARKPYLHESRHQHAMRRARGTGGRF 208
                      69***************************9.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005217.2E-36150211IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115238.039151211IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.7E-27153208IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006166.9E-25154176IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860156176IPR018362CCAAT-binding factor, conserved site
PRINTSPR006166.9E-25185208IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010262Biological Processsomatic embryogenesis
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0055046Biological Processmicrogametogenesis
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 231 aa     Download sequence    Send to blast
MAMQPWWTGT GFGAVSPAVV APGSGAGISL SSNPLGGGAG KGATTQGKKK TADDDPRAES  60
SDDDSQRSGE PKDGSFEEEN QRATSRMPAL ATDYLAPYSH LELNQPMASA TYPYPDAYYT  120
GMVGPYGAQA VAHFQLPGLT HPRMPLPLEV SEEPVYVNAK QYHGILRRRQ SRAKAELERK  180
AIKARKPYLH ESRHQHAMRR ARGTGGRFLN TKKDENGASN GGRTEANKDF R
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A1e-20152216266NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3541160.0AK354116.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1005C04.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003560983.11e-130PREDICTED: nuclear transcription factor Y subunit A-4-like
RefseqXP_010231280.11e-130PREDICTED: nuclear transcription factor Y subunit A-4-like
RefseqXP_014752975.11e-130PREDICTED: nuclear transcription factor Y subunit A-4-like
RefseqXP_014752976.11e-130PREDICTED: nuclear transcription factor Y subunit A-4-like
TrEMBLM7ZZQ11e-171M7ZZQ1_TRIUA; Nuclear transcription factor Y subunit A-1
STRINGBRADI1G11800.11e-130(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP82053649
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G30500.22e-42nuclear factor Y, subunit A7